PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_2797g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 234aa    MW: 26161.6 Da    PI: 8.0868
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_2797g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.82.1e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+l+ +++ +G g+W++ ++  g+ R++k+c++rw +yl
     MA_2797g0010 14 KGAWTKEEDEKLIAYIQAHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding59.66.8e-1967111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++++eEdel+++++++lG++ W++Ia +++ gRt++++k++w+++
     MA_2797g0010  67 RGNFSEEEDELIIKLHALLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.9E-25564IPR009057Homeodomain-like
PROSITE profilePS5129416.669961IPR017930Myb domain
SMARTSM007173.6E-141363IPR001005SANT/Myb domain
SuperFamilySSF466894.67E-3013108IPR009057Homeodomain-like
PfamPF002491.3E-151461IPR001005SANT/Myb domain
CDDcd001671.28E-111661No hitNo description
PROSITE profilePS5129429.15962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-2865116IPR009057Homeodomain-like
SMARTSM007175.7E-1866114IPR001005SANT/Myb domain
PfamPF002493.3E-1767111IPR001005SANT/Myb domain
CDDcd001671.18E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010224Biological Processresponse to UV-B
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:1903086Biological Processnegative regulation of sinapate ester biosynthetic process
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDEKLIAYIQ AHGEGCWRSL PKAAGLLRCG KSCRLRWINY  60
LRPDLKRGNF SEEEDELIIK LHALLGNKWS LIAGRLPGRT DNEIKNYWNT HIKRKLLSRG  120
LDPQTHRPLL SYGQPGKPSV PSDQSKLRPP EIPDFFHSHS ETSFEQPGSD GGSDGHENHP  180
ALDLQLSITL PSILDGAVES KEIVSSMNTN QLNDENKALV CCHLGLQITA LGRR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29141167108B-MYB
1h8a_C2e-291311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00479DAPTransfer from AT4G38620Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1169550.0BT116955.1 Picea glauca clone GQ03810_B19 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010930777.16e-95PREDICTED: myb-related protein 308-like
SwissprotQ9SZP14e-91MYB4_ARATH; Transcription repressor MYB4
TrEMBLA5JYE93e-95A5JYE9_PICGL; R2R3-MYB transcription factor MYB5
STRINGBra033572.1-P4e-90(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.12e-92myb domain protein 4